🌐 DOMPUS
Search Pricing Keywords About Contact Privacy

Dompus

Search by domain name, extension, keyword or historical sales record

Search engine for domains and domain sales: 340M+ registered domains, historical sales records, and marketplace trends — collected from across the internet, all in one place.

Dompus Global Domain Registry Network

Top Registered TLDs

Leading domain extensions by global active registration volume

.com 161.4M ACTIVE
46.8% Market Share VERISIGN
.de 17.8M ACTIVE
Top European ccTLD DENIC
.net 13.2M ACTIVE
Network & Tech VERISIGN
.org 10.9M ACTIVE
Public Interest Registry PIR
.ai +142% YoY
532,000+ Domains AI VENTURES
.io 1.45M ACTIVE
Developer Ecosystem IDENTITY DIGITAL

Recent Domain Sales

Highest recorded sales and verified marketplace transactions

ai.com $11,000,000
2026-09-14 ESCROW.COM
prompt.io $850,000
2026-09-12 SEDO
agent.ai $420,000
2026-09-11 GODADDY BROKER
metaverse.net $275,000
2026-09-10 NAMEJET
cloudpay.com $195,000
2026-09-09 DYNADOT
fintech.co $145,000
2026-09-08 PRIVATE ESCROW

Today's Expired Domains

High-authority dropped and pending-delete domains available for backorder

deepneural.org DA 48
Dropped 1h ago DROPCATCH
fastfintech.net DA 41
Expired 2h ago DYNADOT AUCTION
cryptomart.io DA 36
Pending Delete NAMEJET
smartbotics.com DA 52
Dropped 3h ago GODADDY CLOSEOUT
cloudvector.ai DA 39
Expired 4h ago SAV.COM
databrain.co DA 44
Pending Delete SNAPNAMES

Newly Registered Domains

Fresh registrations streamed live from global authoritative zone files

neuralquantum.ai JUST ADDED
15 mins ago NAMECHEAP
agentchain.io JUST ADDED
35 mins ago GODADDY
hypercompute.com JUST ADDED
1 hour ago DYNADOT
payvector.net JUST ADDED
2 hours ago PORKBUN
synthetica.xyz JUST ADDED
3 hours ago NAMECHEAP
omnicloud.org JUST ADDED
4 hours ago SQUARESPACE
🛡️
Verified Domain Intelligence • Data Synchronized with Zone Operators (Verisign, IANA, ICANN) • Peer Reviewed

🌐 Comprehensive Global Domain & Aftermarket Intelligence

Dompus (domainsearch.online) is an advanced domain research engine indexing more than 340 million active, expired, and historical domain names across 1,500+ top-level extensions (TLDs). Sourced systematically from authoritative registry zone files and verified aftermarket auctions, Dompus provides researchers, security professionals, and domain investors with instant visibility into worldwide namespace trends.

Whether you need to monitor brand names across global registries, analyze historical domain sales comparables, or discover expired domains with high search authority, our sub-15ms search infrastructure delivers comprehensive intelligence directly to your browser.

📈

Domain Investors

Research aftermarket historical sales, evaluate price comparables, discover unregistered gem variations, and track daily dropped domains for backordering.

🛡️

Brand Protection

Identify typo-squatting, detect brand impersonation across new gTLDs and ccTLDs, and monitor trademark infringements before reputational damage occurs.

🔍

Threat Intelligence

Investigate newly observed domains (NOD), track suspicious naming patterns, inspect DNS records, and uncover malicious infrastructure clusters in real time.

💡

Web Creators

Brainstorm startup and project names with instant substring verification, cross-checking availability across hundreds of extensions in a single keystroke.

⚡ High-Speed Inverted Substring Search Technology

Standard registry WHOIS portals and registrar search boxes restrict users to prefix lookups or exact matches, which fail to reveal when your target term is embedded inside longer compound domains. Dompus operates on an inverted n-gram index powered by a custom ClickHouse columnar database:

By splitting domain names into indexed substrings and caching frequent search vectors at the edge, Dompus processes complex substring queries across 340M+ rows in under 15 milliseconds. Users can query with three distinct matching modes: Contains (finds substrings anywhere in the SLD), Exact (identifies identical SLD registrations across all TLDs), and Starts With (rapid prefix scanning).

❓ Frequently Asked Questions

What makes Dompus different from a regular WHOIS lookup?

Traditional WHOIS checks one domain name on a single extension at a time. Dompus searches across 340M+ domains simultaneously, revealing all registered extensions, active DNS status, and historical sales prices in a unified view.

How frequently is the domain index synchronized?

Our infrastructure synchronizes daily with authoritative zone files from Verisign (.com, .net), PIR (.org), and over 1,400 global registry operators accredited by ICANN to ensure fresh registration data.

Where do historical domain sales records come from?

Sales records are compiled from publicly disclosed and verified aftermarket auction transactions, including sales reported on Sedo, GoDaddy Auctions, NameJet, DropCatch, and Dynadot.

Can I search for domains using partial keywords?

Yes. Select the "Contains" search mode to find any domain containing your keyword anywhere in the name (e.g., searching "pay" uncovers domains like "autopay", "payvector", and "smartpayments").

Is Dompus completely free to use?

Yes, all basic search modes, keyword directories, and sales database lookups are free for public research, supported by unobtrusive advertisements.

How do I report a data discrepancy or request API access?

You can reach our engineering team directly via our Contact Page or by emailing [email protected].

Home / Domains / "pv yv"
Keywords matching "pv yv" Contains 580 Domain Count
⚡ Latency: 218.20 ms
Found 580 registered domains matching "pv yv"
tryvipvpn 1 TLDs
EXTENSIONS: .sbs
trannyvipvideos 1 TLDs
EXTENSIONS: .com
zyvpvwoman 1 TLDs
EXTENSIONS: .bond
bqxhidmtsyvcdwcdwopvau 1 TLDs
EXTENSIONS: .org
tpvloyverse 1 TLDs
EXTENSIONS: .com
hadtnshjpvnoylajpyvl 1 TLDs
EXTENSIONS: .com
tipvvgyv 1 TLDs
EXTENSIONS: .top
cityviewrooftopvenue 2 TLDs
EXTENSIONS: .com.nyc
aqewitdxyvhraftpvcwj 1 TLDs
EXTENSIONS: .shop
gvd100uohyvf86u78pv 1 TLDs
EXTENSIONS: .today
shopvictoryvibes 1 TLDs
EXTENSIONS: .com
feo96pv0dyvx2dd-m9 1 TLDs
EXTENSIONS: .com
dannyschimneysweepvalleyvillage 1 TLDs
EXTENSIONS: .com
evcapvfquzheyvpactz 1 TLDs
EXTENSIONS: .shop
deduyvencampvivente 1 TLDs
EXTENSIONS: .nu
1sqyvh-hmawtm-izjpv 2 TLDs
EXTENSIONS: .work.work
hilltopvalleyviews 1 TLDs
EXTENSIONS: .com
hgjhf-wmyvb-dpvqgs 1 TLDs
EXTENSIONS: .work
zipvyve 1 TLDs
EXTENSIONS: .com
zpibqhbedtsskcyvpvorkvmr 1 TLDs
EXTENSIONS: .org
zyvupvao 1 TLDs
EXTENSIONS: .cyou
zwfhpvivyv 1 TLDs
EXTENSIONS: .info
zmyvpvvz 1 TLDs
EXTENSIONS: .sbs
zldivwgyvclnxgtgfbuqoovpvmr 1 TLDs
EXTENSIONS: .org
zpvosgyv 1 TLDs
EXTENSIONS: .lol
zpcpvyvfwygv 1 TLDs
EXTENSIONS: .com
djtjn-wnpyv-wdpvdd 1 TLDs
EXTENSIONS: .xyz
cfi54-zysyv-ydxcpv 1 TLDs
EXTENSIONS: .work
technologyvtapvx 1 TLDs
EXTENSIONS: .bond
2mxjz-yff2z-ayvwpv 2 TLDs
EXTENSIONS: .work.work
1y3pv-u0ogi-hyvxnu 2 TLDs
EXTENSIONS: .work.work
1xusn-9aek9-pvayvj 2 TLDs
EXTENSIONS: .work.work
hfrgicxppvelcyvxd 1 TLDs
EXTENSIONS: .org
7repvqn4nmjx7yvwjw 1 TLDs
EXTENSIONS: .shop
7r6pv-0yzyr-uyvxcy 1 TLDs
EXTENSIONS: .work